Recombinant  Inner membrane protein yidG(yidG)

Recombinant Inner membrane protein yidG(yidG)

CSB-CF364997EGX
Regular price
£874.00 GBP
Sale price
£874.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O6

Uniprot NO.:P0ADL7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPDSRKARRIADPGLQPERTSLAWFRTMLGYGALMALAIKHNWHQAGMLFWISIGILAIV ALILWHYTRNRNLMDVTNSDFSQFHVVRDKFLISLAVLSLAILFAVTHIHQLIVFIERVA

Protein Names:Recommended name: Inner membrane protein yidG

Gene Names:Name:yidG Ordered Locus Names:c4599

Expression Region:1-120

Sequence Info:full length protein

Your list is ready to share