Recombinant Human Sperm mitochondrial-associated cysteine-rich protein(SMCP)

Recombinant Human Sperm mitochondrial-associated cysteine-rich protein(SMCP)

CSB-EP021820HU
Regular price
£424.00 GBP
Sale price
£424.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Developmental Biology

Uniprot ID: P49901

Gene Names: SMCP

Organism: Homo sapiens (Human)

AA Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

Expression Region: 1-116aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.8 kDa

Alternative Name(s):

Relevance: Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida .

Reference: Isolation, expression, and chromosomal localization of the human mitochondrial capsule selenoprotein gene (MCSP).Aho H., Schwemmer M., Tessmann D., Murphy D., Mattei M.-G., Engel W., Adham I.M.Genomics 32:184-190(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share