Recombinant Human Proteasome subunit alpha type-1(PSMA1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Proteasome subunit alpha type-1(PSMA1),partial

CSB-EP018865HU
Regular price
£422.00 GBP
Sale price
£422.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P25786

Gene Names: PSMA1

Organism: Homo sapiens (Human)

AA Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD

Expression Region: 1-251aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 32.2 kDa

Alternative Name(s): 30KDA prosomal protein ;PROS-30Macropain subunit C2Multicatalytic endopeptidase complex subunit C2;Proteasome component C2;Proteasome nu chain

Relevance: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome . Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells .

Reference: "N-terminome analysis of the human mitochondrial proteome."Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M., Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.Proteomics 15:2519-2524(2015)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Proteasome subunit alpha type-7(PSMA7),partial
    Regular price
    £422.00 GBP
    Sale price
    £422.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Proteasome subunit beta type-8(PSMB8)
    Regular price
    £422.00 GBP
    Sale price
    £422.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Proteasome subunit beta type-7(PSMB7),partial
    Regular price
    £422.00 GBP
    Sale price
    £422.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Proteasome subunit beta type-1(PSMB1)
    Regular price
    £422.00 GBP
    Sale price
    £422.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share