Recombinant Human Platelet glycoprotein Ib beta chain(GP1BB)

Recombinant Human Platelet glycoprotein Ib beta chain(GP1BB)

CSB-CF009686HU
Regular price
£960.00 GBP
Sale price
£960.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: GP1BB

Biologically active: Not Tested

Expression system: in vitro E.coli expression system

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P13224

AA Sequence: CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 26-206aa

Protein length: Full Length of Mature Protein

MW: 39.3 kDa

Alternative Name(s): Antigen CD42b-beta CD_antigen: CD42c

Relevance: Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

Reference: "The alpha and beta chains of human platelet glycoprotein Ib are both transmembrane proteins containing a leucine-rich amino acid sequence." Lopez J.A., Chung D.W., Fujikawa K., Hagen F.S., Davie E.W., Roth G.J. Proc. Natl. Acad. Sci. U.S.A. 85:2135-2139(1988)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share