Recombinant Human Oxytocin-neurophysin 1(OXT),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Oxytocin-neurophysin 1(OXT),partial

CSB-YP017315HU
Regular price
£609.00 GBP
Sale price
£609.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P01178

Gene Names: OXT

Organism: Homo sapiens (Human)

AA Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Expression Region: 32-125aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11.6 kDa

Alternative Name(s): Ocytocin

Relevance: Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.

Reference: "The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation." Rehbein M., Hillers M., Mohr E., Ivell R., Morley S., Schmale H., Richter D. Biol. Chem. Hoppe-Seyler 367:695-704(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Oxytocin-neurophysin 1(OXT)
    Regular price
    £609.00 GBP
    Sale price
    £609.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Oxytocin-neurophysin 1(OXT)
    Regular price
    £675.00 GBP
    Sale price
    £675.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Oxytocin-neurophysin 1(OXT),partial
    Regular price
    £610.00 GBP
    Sale price
    £610.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Oxytocin-neurophysin 1(OXT),partial
    Regular price
    £475.00 GBP
    Sale price
    £475.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share