Recombinant Human Leukocyte-specific transcript 1 protein(LST1)

Recombinant Human Leukocyte-specific transcript 1 protein(LST1)

CSB-EP013217HU
Regular price
£540.00 GBP
Sale price
£540.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: O00453

Gene Names: LST1

Organism: Homo sapiens (Human)

AA Sequence: MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Expression Region: 1-66aa

Sequence Info: Full Length of Isoform 10

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 11.5 kDa

Alternative Name(s): Protein B144

Relevance: Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Reference: "Complex expression pattern of the TNF region gene LST1 through differential regulation, initiation, and alternative splicing." de Baey A., Fellerhoff B., Maier S., Martinozzi S., Weidle U., Weiss E.H. Genomics 45:591-600(1997)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share