Recombinant Human Kita-kyushu lung cancer antigen 1(KKLC1)

Recombinant Human Kita-kyushu lung cancer antigen 1(KKLC1)

CSB-EP711093HU
Regular price
£478.00 GBP
Sale price
£478.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q5H943

Gene Names: CT83

Organism: Homo sapiens (Human)

AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Expression Region: 1-113aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 26.8 kDa

Alternative Name(s): Cancer/testis antigen 83

Relevance:

Reference: "CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer." Paret C., Simon P., Vormbrock K., Bender C., Kolsch A., Breitkreuz A., Yildiz O., Omokoko T., Hubich-Rau S., Hartmann C., Hacker S., Wagner M., Roldan D.B., Selmi A., Tureci O., Sahin U. Oncotarget 6:25356-25367(2015)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share