Recombinant Human Elafin(PI3)

Recombinant Human Elafin(PI3)

CSB-EP017952HU
Regular price
£422.00 GBP
Sale price
£422.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P19957

Gene Names: PI3

Organism: Homo sapiens (Human)

AA Sequence: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Expression Region: 61-117aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 22 kDa

Alternative Name(s): Elastase-specific inhibitor ;ESIPeptidase inhibitor 3 ;PI-3;Protease inhibitor WAP3Skin-derived antileukoproteinase ;SKALPWAP four-disulfide core domain protein 14

Relevance: Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Reference: Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment.Saheki T., Ito F., Hagiwara H., Saito Y., Kuroki J., Tachibana S., Hirose S.Biochem. Biophys. Res. Commun. 185:240-245(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share