Recombinant Human CD81 antigen(CD81),partial

Recombinant Human CD81 antigen(CD81),partial

CSB-EP004960HU
Regular price
£424.00 GBP
Sale price
£424.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P60033

Gene Names: CD81

Organism: Homo sapiens (Human)

AA Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Expression Region: 113-201aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 25.8 kDa

Alternative Name(s): 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ;Tspan-28; CD81

Relevance: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.

Reference: TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share