
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Apoptosis
Target / Protein: CASP1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P29466
AA Sequence: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Tag info: N-terminal GST-tagged
Expression Region: 120-269aa
Protein length: Partial
MW: 43.8 kDa
Alternative Name(s): Interleukin-1 beta convertase ;IL-1BCInterleukin-1 beta-converting enzyme ;ICE ;IL-1 beta-converting enzymep45
Relevance: Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory elent binding proteins (SREBPs). Can also promote apoptosis.
Reference: A novel heterodimeric cysteine protease is required for interleukin-1 beta processing in monocytes.Thornberry N.A., Bull H.G., Calaycay J.R., Chapman K.T., Howard A.D., Kostura M.J., Miller D.K., Molineaux S.M., Weidner J.R., Aunins J., Elliston K.O., Ayala J.M., Casano F.J., Chin J., Ding G.J.-F., Egger L.A., Gaffney E.P., Limjuco G. , Palyha O.C., Raju M., Rolando A.M., Salley J.P., Yamin T.-T., Lee T.D., Shively J.E., McCross M., Mumford R.A., Schmidt J.A., Tocci M.J.Nature 356:768-774(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Caspase-1(CASP1),partial
- Regular price
- £421.00 GBP
- Sale price
- £421.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
CASP1 Antibody, Biotin conjugated - Cat. #: CSB-PA05824D0Rb
- Regular price
- £257.00 GBP
- Sale price
- £257.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
CASP1 Antibody, Biotin conjugated - Cat. #: CSB-PA05829D0Rb
- Regular price
- £257.00 GBP
- Sale price
- £257.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
CASP1 Antibody - Cat. #: CSB-PA05824A0Rb
- Regular price
- £257.00 GBP
- Sale price
- £257.00 GBP
- Regular price
-
- Unit price
- per
Sold out