Recombinant Escherichia coli  Uncharacterized protein yfgG(yfgG)

Recombinant Escherichia coli Uncharacterized protein yfgG(yfgG)

CSB-CF353730ENV
Regular price
£833.00 GBP
Sale price
£833.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P64545

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQATSMRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESP VQR

Protein Names:Recommended name: Uncharacterized protein yfgG

Gene Names:Name:yfgG Ordered Locus Names:b2504, JW5399

Expression Region:1-63

Sequence Info:full length protein

Your list is ready to share