Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC(lptC)

Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC(lptC)

CSB-EP360015EGXa2
Regular price
£634.00 GBP
Sale price
£634.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0ADW0

Gene Names: lptC

Organism: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

AA Sequence: MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP

Expression Region: 1-191aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 37.7 kDa

Alternative Name(s):

Relevance: Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. Facilitates the transfer of LPS from the inner mbrane to the periplasmic protein LptA. Could be a docking site for LptA.

Reference: Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli.Welch R.A., Burland V., Plunkett G. III, Redford P., Roesch P., Rasko D., Buckles E.L., Liou S.-R., Boutin A., Hackett J., Stroud D., Mayhew G.F., Rose D.J., Zhou S., Schwartz D.C., Perna N.T., Mobley H.L.T., Donnenberg M.S., Blattner F.R.Proc. Natl. Acad. Sci. U.S.A. 99:17020-17024(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share