
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Microbiology
Uniprot ID: P60472
Gene Names: ispU
Organism: Escherichia coli (strain K12)
AA Sequence: MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA
Expression Region: 1-253aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 32.4 kDa
Alternative Name(s): Ditrans,polycis-undecaprenylcistransferase Undecaprenyl diphosphate synthase Short name: UDS Undecaprenyl pyrophosphate synthase Short name: UPP synthase
Relevance: Generates ditrans,octacis-undecaprenyl pyrophosphate (UPP) from isopentenyl pyrophosphate (IPP) and farnesyl diphosphate (FPP). UPP is the precursor of glycosyl carrier lipid in the biosynthesis of bacterial cell wall polysaccharide components such as peptidoglycan and lipopolysaccharide.
Reference: "Catalytic mechanism revealed by the crystal structure of undecaprenyl pyrophosphate synthase in complex with sulfate, magnesium, and triton."Chang S.-Y., Ko T.-P., Liang P.-H., Wang A.H.-J.J. Biol. Chem. 278:29298-29307(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Farnesyl pyrophosphate synthase(FDPS)
- Regular price
- £537.00 GBP
- Sale price
- £537.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Undecaprenyl-diphosphatase(uppP)
- Regular price
- £960.00 GBP
- Sale price
- £960.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Undecaprenyl-diphosphatase(uppP)
- Regular price
- £960.00 GBP
- Sale price
- £960.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli O127:H6 Undecaprenyl-diphosphatase(uppP)
- Regular price
- £960.00 GBP
- Sale price
- £960.00 GBP
- Regular price
-
- Unit price
- per
Sold out