Recombinant Drosophila yakuba  NADH-ubiquinone oxidoreductase chain 3(mt:ND3)

Recombinant Drosophila yakuba NADH-ubiquinone oxidoreductase chain 3(mt:ND3)

CSB-CF015078DMR-GB
Regular price
£867.00 GBP
Sale price
£867.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila yakuba (Fruit fly)

Uniprot NO.:P07705

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSIIIIASVILLITTVVMFLASILSKKALIDREKSSPFECGFDPKSSSRLPFSLRFFLI TIIFLIFDVEIALILPMIIILKYSNIMIWTITSIIFILILLIGLYHEWNQGMLNWSN

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3

Gene Names:Name:mt:ND3 Synonyms:ND3

Expression Region:1-117

Sequence Info:full length protein

Your list is ready to share