Recombinant Danio rerio  Nuclear envelope phosphatase-regulatory subunit 1(cnep1r1)

Recombinant Danio rerio Nuclear envelope phosphatase-regulatory subunit 1(cnep1r1)

CSB-CF684914DIL
Regular price
£876.00 GBP
Sale price
£876.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q561X0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSLEQAEDLKAFERRLTEYVSCLQPATGRWRMILIVVSVCTATGAWNWLIDPDTQKVSF FSSLWNHPFFTISCVTLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHIQ

Protein Names:Recommended name: Nuclear envelope phosphatase-regulatory subunit 1 Alternative name(s): Transmembrane protein 188

Gene Names:Name:cnep1r1 Synonyms:tmem188 ORF Names:zgc:110674

Expression Region:1-125

Sequence Info:full length protein

Your list is ready to share