
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cuscuta reflexa (Southern Asian dodder)
Uniprot NO.:A7M953
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV
Protein Names:Recommended name: ATP synthase subunit C, plastid Alternative name(s): ATP synthase F0 sector subunit C ATPase subunit III Lipid-binding protein
Gene Names:Name:atpE Synonyms:atpH
Expression Region:1-81
Sequence Info:full length protein
You may also like
-
Recombinant Cuscuta exaltata ATP synthase subunit C, plastid(atpE)
- Regular price
- £1,055.00 GBP
- Sale price
- £1,055.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cuscuta reflexa ATP synthase subunit b, plastid(atpF)
- Regular price
- £1,136.00 GBP
- Sale price
- £1,136.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cuscuta obtusiflora ATP synthase subunit C, plastid(atpE)
- Regular price
- £1,055.00 GBP
- Sale price
- £1,055.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cuscuta gronovii ATP synthase subunit C, plastid(atpE)
- Regular price
- £1,055.00 GBP
- Sale price
- £1,055.00 GBP
- Regular price
-
- Unit price
- per
Sold out