Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase

CSB-YP520546DYB
Regular price
£701.00 GBP
Sale price
£701.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: F8S114

Gene Names: N/A

Organism: Crotalus adamanteus (Eastern diamondback rattlesnake)

AA Sequence: VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP

Expression Region: 25-262aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 28.8 kDa

Alternative Name(s):

Relevance: Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA). Shows both kinin-releasing and coagulant activities.

Reference: Kallikrein-like activity of crotalase, a snake venom enzyme that clots fibrinogen.Markland F.S., Kettner C., Schiffman S., Shaw E., Bajwa S.S., Reddy K.N., Kirakossian H., Patkos G.B., Theodor I., Pirkle H.Proc. Natl. Acad. Sci. U.S.A. 79:1688-1692(1982)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase(SVTLE)
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Crotalus adamanteus Zinc metalloproteinase adamalysin-2
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Plasma kallikrein(Klkb1),partial
    Regular price
    £542.00 GBP
    Sale price
    £542.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share