
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: F8S114
Gene Names: N/A
Organism: Crotalus adamanteus (Eastern diamondback rattlesnake)
AA Sequence: VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP
Expression Region: 25-262aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 28.8 kDa
Alternative Name(s):
Relevance: Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA). Shows both kinin-releasing and coagulant activities.
Reference: Kallikrein-like activity of crotalase, a snake venom enzyme that clots fibrinogen.Markland F.S., Kettner C., Schiffman S., Shaw E., Bajwa S.S., Reddy K.N., Kirakossian H., Patkos G.B., Theodor I., Pirkle H.Proc. Natl. Acad. Sci. U.S.A. 79:1688-1692(1982)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase(SVTLE)
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Crotalus adamanteus Zinc metalloproteinase adamalysin-2
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Plasma kallikrein(Klkb1),partial
- Regular price
- £542.00 GBP
- Sale price
- £542.00 GBP
- Regular price
-
- Unit price
- per
Sold out