Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cricetulus griseus P2Y purinoceptor 2(P2RY2)

Recombinant Cricetulus griseus P2Y purinoceptor 2(P2RY2)

SKU:CSB-CF017334DXU

Regular price £1,265.00 GBP
Regular price Sale price £1,265.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Uniprot NO.:P58825

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTRITCHDTSA RELFSHFVAYSSVMLSLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAKRKSVRTIA LVLAVFTLCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPL

Protein Names:Recommended name: P2Y purinoceptor 2 Short name= P2Y2

Gene Names:Name:P2RY2

Expression Region:1-166

Sequence Info:full length protein

View full details