Gene Bio Systems
Recombinant Cricetulus griseus P2Y purinoceptor 2(P2RY2)
Recombinant Cricetulus griseus P2Y purinoceptor 2(P2RY2)
SKU:CSB-CF017334DXU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Uniprot NO.:P58825
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTRITCHDTSA RELFSHFVAYSSVMLSLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAKRKSVRTIA LVLAVFTLCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPL
Protein Names:Recommended name: P2Y purinoceptor 2 Short name= P2Y2
Gene Names:Name:P2RY2
Expression Region:1-166
Sequence Info:full length protein
