Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chondrus crispus (Carragheen moss) (Irish moss)
Uniprot NO.:P48934
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFIKFKISNRPIAPHLLVYTPQLSSLFSIWHRISGVGLAFFFTTFLIFIRIILSSNFACN LLTLISFEISQWIIIYFNLFILLFLFYHLFNGTRHIIWDFGFLLDIKYLSKFSLFLLVSL SLILIFQ
Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit Alternative name(s): Succinate dehydrogenase, subunit III
Gene Names:Name:SDH3 Synonyms:SDHC
Expression Region:1-127
Sequence Info:full length protein