Recombinant Caulobacter crescentus  UPF0391 membrane protein CC_0673(CC_0673)

Recombinant Caulobacter crescentus UPF0391 membrane protein CC_0673(CC_0673)

CSB-CF860534DQO
Regular price
£831.00 GBP
Sale price
£831.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caulobacter crescentus (strain ATCC 19089 / CB15)

Uniprot NO.:Q9AAC9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKWAIILAIVALIAGALGFSGLAGAAAGVAKILFFLFLVGFVLVLLLGGTVFKAATGPK

Protein Names:Recommended name: UPF0391 membrane protein CC_0673

Gene Names:Ordered Locus Names:CC_0673

Expression Region:1-60

Sequence Info:full length protein

Your list is ready to share