
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q3ZBP2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ
Protein Names:Recommended name: Nuclear envelope phosphatase-regulatory subunit 1 Alternative name(s): Transmembrane protein 188
Gene Names:Name:CNEP1R1 Synonyms:TMEM188
Expression Region:1-125
Sequence Info:full length protein
You may also like
-
Recombinant Mouse Nuclear envelope phosphatase-regulatory subunit 1(Cnep1r1)
- Regular price
- £874.00 GBP
- Sale price
- £874.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Nuclear envelope phosphatase-regulatory subunit 1(CNEP1R1)
- Regular price
- £874.00 GBP
- Sale price
- £874.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pongo abelii Nuclear envelope phosphatase-regulatory subunit 1(CNEP1R1)
- Regular price
- £874.00 GBP
- Sale price
- £874.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nuclear envelope phosphatase-regulatory subunit 1 homolog(T19A6.3)
- Regular price
- £884.00 GBP
- Sale price
- £884.00 GBP
- Regular price
-
- Unit price
- per
Sold out