
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A4IFL0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEF ILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMV TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGAARG GLAGLTLTGLYALYNNWEHMKGSVLQQSL
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit Tim23
Gene Names:Name:TIMM23 Synonyms:TIM23
Expression Region:1-209
Sequence Info:Full length protein
You may also like
-
Recombinant Bovine Mitochondrial import inner membrane translocase subunit Tim22(TIMM22)
- Regular price
- £911.00 GBP
- Sale price
- £911.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Mitochondrial import inner membrane translocase subunit TIM50(TIMM50)
- Regular price
- £984.00 GBP
- Sale price
- £984.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Mitochondrial import inner membrane translocase subunit Tim23(Timm23)
- Regular price
- £921.00 GBP
- Sale price
- £921.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Mitochondrial import inner membrane translocase subunit Tim21(TIMM21)
- Regular price
- £931.00 GBP
- Sale price
- £931.00 GBP
- Regular price
-
- Unit price
- per
Sold out