
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O66377
Gene Names: cry1Fb
Organism: Bacillus thuringiensis subsp. morrisoni
AA Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE
Expression Region: 984-1169aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 47.8 kDa
Alternative Name(s): 132KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF(b)
Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.
Reference: A novel cry1Fb gene from Bacillus thuringiensis subsp. morrisoni.Song F., Zhang J., Ding Z., Chen Z., Li G., Huang D.Masuda K., Asano S.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein Cry1Fb(cry1Fb),partial
- Regular price
- £679.00 GBP
- Sale price
- £679.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pesticidal crystal protein cry1Fb(cry1Fb),partial
- Regular price
- £875.00 GBP
- Sale price
- £875.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ab(cry1Ab),partial
- Regular price
- £875.00 GBP
- Sale price
- £875.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab(cry1Ab),partial
- Regular price
- £798.00 GBP
- Sale price
- £798.00 GBP
- Regular price
-
- Unit price
- per
Sold out