Recombinant Bacillus subtilis  SPBc2 prophage-derived uncharacterized membrane protein yosE(yosE)

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosE(yosE)

CSB-CF518309BRJ
Regular price
£865.00 GBP
Sale price
£865.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O31884

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKDTKDIWSGFFMGSGSLIVVGLLIFVEALTMSLIVYYGLNHVLNPLLIDTYNIQNVHV TLPHAFVIGVLLNVFVKGVKRSDQEKDENIFKKAGKSLFHSTFALIVLYVSTLFI

Protein Names:Recommended name: SPBc2 prophage-derived uncharacterized membrane protein yosE

Gene Names:Name:yosE Ordered Locus Names:BSU20150

Expression Region:1-115

Sequence Info:full length protein

Your list is ready to share