
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein: pbpC
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Bacillus subtilis (strain 168)
Delivery time: 3-7 business days
Uniprot ID: P42971
AA Sequence: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
Tag info: N-terminal 6xHis-tagged
Expression Region: 21-240aa
Protein length: Partial
MW: 29.2 kDa
Alternative Name(s): PBP 3 Alternative name(s): PSPB20 Penicillin-binding protein C
Relevance:
Reference: "The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Bacillus subtilis Penicillin-binding protein 3(pbpC),partial
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Penicillin-binding protein 4(pbpD) ,partial
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Penicillin-binding protein 4(pbpD),partial
- Regular price
- £632.00 GBP
- Sale price
- £632.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Penicillin-binding protein 1A/1B(ponA),partial
- Regular price
- £621.00 GBP
- Sale price
- £621.00 GBP
- Regular price
-
- Unit price
- per
Sold out