Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)

Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)

CSB-EP365470BQT
Regular price
£636.00 GBP
Sale price
£636.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: apr

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bacillus licheniformis

Delivery time: 3-7 business days

Uniprot ID: P00780

AA Sequence: AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ

Tag info: N-terminal 10xHis-SUMO-tagged

Expression Region: 106-379aa

Protein length: Full Length of Mature protein

MW: 45.8 kDa

Alternative Name(s):

Relevance: Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.

Reference: "Subtilisin Carlsberg. V. The complete sequence; comparison with subtilisin BPN'; evolutionary relationships." Smith E.L., Delange R.J., Evans W.H., Landon M., Markland F.S. J. Biol. Chem. 243:2184-2191(1968)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share