Recombinant  ATP synthase protein I, sodium ion specific(atpI)

Recombinant ATP synthase protein I, sodium ion specific(atpI)

CSB-CF333467PSI
Regular price
£878.00 GBP
Sale price
£878.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Propionigenium modestum

Uniprot NO.:P29705

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQEIKKILKNSLITSLIVLVYGIVVRNPIVYFGMFVGCLISTFCFYMICQEAESAMKSG SPFKMTVTGYMKRYAIYGIYLGILVKFFGFPVFLGGAVGLLNIKFNIFLKVVSTQFEKIK KKLSSLK

Protein Names:Recommended name: ATP synthase protein I, sodium ion specific

Gene Names:Name:atpI Synonyms:uncI

Expression Region:1-127

Sequence Info:full length protein

Your list is ready to share