Recombinant Arabidopsis thaliana  Protein TIC 21, chloroplastic(TIC21)

Recombinant Arabidopsis thaliana Protein TIC 21, chloroplastic(TIC21)

CSB-CF882859DOA
Regular price
£926.00 GBP
Sale price
£926.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SHU7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SVPGDNEVDKAKLAQVAKRLEKTSRYFKRLGSIGFWGQLVSTVVAAVILSFSIVVTGKPT SPATFYATASGIAAAFVSVFWSFGYIRLSERLRRTSIDPAKAPPRADVVKGLRSGIMVNI LGMGSALLGMQATVGFLVAKALTTSANPFYQGVSQGYSPVLALDVFLVQASANTLLSHFL GLVCSLELLRSVTVPNSESVVVPKVA

Protein Names:Recommended name: Protein TIC 21, chloroplastic Alternative name(s): Protein CHLOROPLAST IMPORT APPARATUS 5 Short name= AtCIA5 Protein PERMEASE IN CHLOROPLASTS 1 Short name= AtPIC1 Translocon at the inner envelope membrane of

Gene Names:Name:TIC21 Synonyms:CIA5, PIC1 Ordered Locus Names:At2g15290 ORF Names:F27O10.6

Expression Region:91-296

Sequence Info:full length protein

Your list is ready to share