Recombinant Arabidopsis thaliana  Chlorophyll a-b binding protein 3, chloroplastic(LHCB1.2)

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 3, chloroplastic(LHCB1.2)

CSB-CF840912DOA
Regular price
£944.00 GBP
Sale price
£944.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8VZ87

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 3, chloroplastic Alternative name(s): Chlorophyll a-b protein 180 Short name= CAB-180 LHCII type I CAB-3

Gene Names:Name:LHCB1.2 Synonyms:AB180, CAB3, LHCP-A Ordered Locus Names:At1g29910 ORF Names:F1N18.5

Expression Region:36-267

Sequence Info:full length protein

Your list is ready to share