Recombinant Alternaria alternata Major allergen Alt a 1(ALTA1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Alternaria alternata Major allergen Alt a 1(ALTA1)

CSB-EP303588AZV
Regular price
£798.00 GBP
Sale price
£798.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P79085

Gene Names: ALTA1

Organism: Alternaria alternata (Alternaria rot fungus) (Torula alternata)

AA Sequence: APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS

Expression Region: 19-157aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 19.2 kDa

Alternative Name(s): Allergen: Alt a 1

Relevance:

Reference: Isolation and expression of a cDNA clone encoding an Alternaria alternata Alt a 1 subunit.De Vouge M.W., Thaker A.J., Curran I.H., Zhang L., Muradia G., Rode H., Vijay H.M.Int. Arch. Allergy Immunol. 111:385-395(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Alternaria alternata Major allergen Alt a 1(ALTA1)
    Regular price
    £876.00 GBP
    Sale price
    £876.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Alternaria alternata Heat shock 70KDA protein(HSP70)
    Regular price
    £798.00 GBP
    Sale price
    £798.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Alternaria alternata Heat shock 70KDA protein(HSP70)
    Regular price
    £876.00 GBP
    Sale price
    £876.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Alternaria alternata Superoxide dismutase [Mn], mitochondrial
    Regular price
    £798.00 GBP
    Sale price
    £798.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share