
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Uniprot NO.:C5DTC6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LGLSSHAEPWSQMSLKELKVECKNRGLKVSGKKIELVRRLKNLNITNSNDSHLRIDIDRP KPPRNKSKKQVKPINSNVKLDRNIVLNSRINDTITKENDTTPTINESNVKTSPIEHVQNP PVEHMQEPPVDHFGKSSPIKESKDIITTTRPYANGFSTDQDNYQTNSLALRDKIFLLTST TCITIWWWWPHMPSFIDQILKSYKYLQSFL
Protein Names:Recommended name: Altered inheritance of mitochondria protein 34, mitochondrial
Gene Names:Name:AIM34 Ordered Locus Names:ZYRO0C07392g
Expression Region:13-222
Sequence Info:full length protein
You may also like
-
Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 36, mitochondrial(AIM36)
- Regular price
- €1.330,95 EUR
- Sale price
- €1.330,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
- Regular price
- €1.291,95 EUR
- Sale price
- €1.291,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 43, mitochondrial(AIM43)
- Regular price
- €1.280,95 EUR
- Sale price
- €1.280,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 39, mitochondrial(AIM39)
- Regular price
- €1.406,95 EUR
- Sale price
- €1.406,95 EUR
- Regular price
-
- Unit price
- per
Sold out