Gene Bio Systems
Recombinant Zea mays Cell number regulator 4(CNR4)
Recombinant Zea mays Cell number regulator 4(CNR4)
SKU:CSB-CF520621ZAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zea mays (Maize)
Uniprot NO.:D9HP20
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTYPPPTGEWTTGLCGCFSDCKSCCLSFLCPCIPFGQVAEVLDKGMTSCGLAGLLYCLL LHAGVAVVPCHCIYTCTYRRKLRAAYDLPPEPCADCCVHMWCGPCAISQMYRELKNRGAD PAMGRQPAFSLSLTSHCRFFLKSKYYHIIKKNWRTVKYG
Protein Names:Recommended name: Cell number regulator 4 Alternative name(s): ZmCNR04
Gene Names:Name:CNR4
Expression Region:1-159
Sequence Info:full length protein
