Recombinant Zaire ebolavirus Nucleoprotein(NP) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Zaire ebolavirus Nucleoprotein(NP) ,partial

CSB-EP323576ZAB
Regular price
€922,95 EUR
Sale price
€922,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P18272

Gene Names: NP

Organism: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

AA Sequence: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Expression Region: 488-739aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 33.1 kDa

Alternative Name(s): Nucleocapsid protein ;Protein N

Relevance: Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as tplate for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.

Reference: Mapping of the VP40-binding regions of the nucleoprotein of Ebola virus.Noda T., Watanabe S., Sagara H., Kawaoka Y.J. Virol. 81:3554-3562(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
    Regular price
    €1.011,95 EUR
    Sale price
    €1.011,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
    Regular price
    €784,95 EUR
    Sale price
    €784,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
    Regular price
    €1.012,95 EUR
    Sale price
    €1.012,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Zaire ebolavirus Nucleoprotein(NP),partial
    Regular price
    €784,95 EUR
    Sale price
    €784,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share