Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yop proteins translocation protein S(yscS)

Recombinant Yop proteins translocation protein S(yscS)

SKU:CSB-CF300908YAS

Regular price €1.369,95 EUR
Regular price Sale price €1.369,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis

Uniprot NO.:P69982

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV TLFATASWLGNELHSFAEMTMMKIQGIR

Protein Names:Recommended name: Yop proteins translocation protein S

Gene Names:Name:yscS Ordered Locus Names:YPCD1.45, y5033, y0036, YP_pCD38

Expression Region:1-88

Sequence Info:full length protein

View full details