Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis UPF0266 membrane protein YPDSF_1369 (YPDSF_1369)

Recombinant Yersinia pestis UPF0266 membrane protein YPDSF_1369 (YPDSF_1369)

SKU:CSB-CF391981YAL

Regular price €1.440,95 EUR
Regular price Sale price €1.440,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis (strain Pestoides F)

Uniprot NO.:A4TKE6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS

Protein Names:Recommended name: UPF0266 membrane protein YPDSF_1369

Gene Names:Ordered Locus Names:YPDSF_1369

Expression Region:1-153

Sequence Info:full length protein

View full details