Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis F1 capsule antigen(caf1)

Recombinant Yersinia pestis F1 capsule antigen(caf1)

SKU:CSB-EP338792YAS

Regular price €1.014,95 EUR
Regular price Sale price €1.014,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: caf1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Yersinia pestis

Delivery time: 3-7 business days

Uniprot ID: P26948

AA Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Tag info: N-terminal 6xHis-tagged

Expression Region: 22-170aa

Protein length: Full Length of Mature Protein

MW: 19.6 kDa

Alternative Name(s):

Relevance:

Reference: "Nucleotide sequence of the Yersinia pestis gene encoding F1 antigen and the primary structure of the protein. Putative T and B cell epitopes." Galyov E.E., Smirnov O.Y., Karlishev A.V., Volkovoy K.I., Denesyuk A.I., Nazimov I.V., Rubtsov K.S., Abramov V.M., Dalvadyanz S.M., Zav'Yalov V.P. FEBS Lett. 277:230-232(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details