Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis Arginine exporter protein ArgO(argO)

Recombinant Yersinia pestis Arginine exporter protein ArgO(argO)

SKU:CSB-CF391960YAL

Regular price €1.487,95 EUR
Regular price Sale price €1.487,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pestis (strain Pestoides F)

Uniprot NO.:A4TI93

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL

Protein Names:Recommended name: Arginine exporter protein ArgO

Gene Names:Name:argO Ordered Locus Names:YPDSF_0595

Expression Region:1-205

Sequence Info:full length protein

View full details