Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia enterocolitica Invasin,partial

Recombinant Yersinia enterocolitica Invasin,partial

SKU:CSB-EP321672YAQ

Regular price €910,95 EUR
Regular price Sale price €910,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Yersinia enterocolitica

Delivery time: 3-7 business days

Uniprot ID: P19196

AA Sequence: VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 651-835aa

Protein length: Partial

MW: 36.3 kDa

Alternative Name(s):

Relevance: Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.

Reference: "Sequence, localization and function of the invasin protein of Yersinia enterocolitica."Young V.B., Miller V.L., Falkow S., Schoolnik G.K.Mol. Microbiol. 4:1119-1128(1990).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details