Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog

Recombinant Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog

SKU:CSB-CF750785XBF

Regular price €1.387,95 EUR
Regular price Sale price €1.387,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q6P1V1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQTEKIEEAVPSYLCEEPPEGTVKDHPQQQPGMISRVTGGIFSMTKGAVGATIGGVAWI GGKSYEVTKTAVTSVPSIGVGIVKGSVSAVTGSVAAVGSVVSSKVSGKKKDKSD

Protein Names:Recommended name: UPF0444 transmembrane protein C12orf23 homolog

Gene Names:

Expression Region:1-114

Sequence Info:full length protein

View full details