Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Transmembrane protein 17A(tmem17-a)

Recombinant Xenopus tropicalis Transmembrane protein 17A(tmem17-a)

SKU:CSB-CF708387XBF

Regular price €1.470,95 EUR
Regular price Sale price €1.470,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q5HZD4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQAAGVRRQLDSLTRNIFLRDVGRTVPEKSGAPLTGDSEVAPSVSLQIFLYFNAFYFPF WWVCYVIMLQLKYVLLPDYYKFILVVLLILMSVIEVIRLYLGYSGNLQEKVPELAGFCLL SILLQLPLLLFLLCDPGLEPLPLERAVHGILTAFLLIQIPISIFALRKATRHLAGRFHLL GDLDGRA

Protein Names:Recommended name: Transmembrane protein 17A

Gene Names:Name:tmem17-a

Expression Region:1-187

Sequence Info:full length protein

View full details