Gene Bio Systems
Recombinant Xenopus tropicalis Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 1(nkain1)
Recombinant Xenopus tropicalis Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 1(nkain1)
SKU:CSB-CF610246XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q0IHU6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGRCSGRCTLVGICCLQLAAALQRQIFDFLGYQWAPILANFLHIMVVILGILGTLHYRSR YLILYSIWLALWVAWNAFIICFYLEVGHFSQHRDLIMNFNTSMHRSWWMENGPGCLVTPV RGPPLPLADHHMVTVTGCLLDYPYIEALSSALQIFLALFGFVYACYVSKVFMDEEDSFDF IGSYDSYGYQAPMKTSHLQLQPLYKPG
Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1 Alternative name(s): Protein FAM77C
Gene Names:Name:nkain1 Synonyms:fam77c
Expression Region:1-207
Sequence Info:full length protein
