Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Low-density lipoprotein receptor class A domain-containing protein 3(ldlrad3)

Recombinant Xenopus tropicalis Low-density lipoprotein receptor class A domain-containing protein 3(ldlrad3)

SKU:CSB-CF012849XBF

Regular price €1.605,95 EUR
Regular price Sale price €1.605,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:A4IHY6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QLLPGNNHTTECNIPGNFMCSNGRCIPGGWQCDGNPDCFDESDEKECPRARSRCGPNFFPCTSGIHCIIARFQCNGFEDCPDGSDEENCTAHPLLCSNSRFHCKNHLCIDKSFVCDGQNNCLDNSDEEHCHSPQEPGSEQDYVSSENQLLYYPSITYTIIGSSVIFVLVVALLALVLHHQRKRNLMSLPVHRLQHPLLLSRLVVLDHPHHCRVTYNVNNGIQYMSGQGYQQPVSVESPPSYTEAVLDHSSRPPWFDLPPPPYPSDMESVSQTELPPYRSRTGSSASAGSTEHPRGTPCGTESPTEPQDPTAAPSDDLPSTEVDV

Protein Names:Recommended name: Low-density lipoprotein receptor class A domain-containing protein 3

Gene Names:Name:ldlrad3

Expression Region:14-337

Sequence Info:full length protein

View full details