Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis E3 ubiquitin-protein ligase MARCH8(41341)

Recombinant Xenopus tropicalis E3 ubiquitin-protein ligase MARCH8(41341)

SKU:CSB-CF638987XBF

Regular price €1.540,95 EUR
Regular price Sale price €1.540,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q28IK8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHSCWKMKLQNEKTLGHSVSRSSNISKAGSPTSVSAPSSFPRTSVTPSSQDICRICHCEG DDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKFEFIMETKLKPLRKWEKLQM TASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKMGQNNGILEWPFWTKLVVVAIG FTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETCKKKIFEKSVIIEPNLESKEALG IHHSDTNSSYYTEPEDCGAAILQV

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH8 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 8 Membrane-associated RING-CH protein VIII Short name= MARCH-VIII

Gene Names:Name:march8 ORF Names:TNeu072c23.1

Expression Region:1-264

Sequence Info:full length protein

View full details