Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis E3 ubiquitin-protein ligase MARCH2(41335)

Recombinant Xenopus tropicalis E3 ubiquitin-protein ligase MARCH2(41335)

SKU:CSB-CF637946XBF

Regular price €1.536,95 EUR
Regular price Sale price €1.536,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q28EX7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTGDCCHLPGSLCDCTGSATFLKSLEESDLGRPQYVTQVTAKDGQLLSTVIKALGTQSD GPICRICHEGGNGERLLSPCDCTGTLGTVHKTCLEKWLSSSNTSYCELCHTEFAVERRPR PVTEWLKDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLQFNSRLEAVGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVLLLIPDSKTAPTTHHSLLSSKLLKSA SDETTV

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH2 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II Short name= MARCH-II

Gene Names:Name:march2 ORF Names:TGas088c08.1

Expression Region:1-246

Sequence Info:full length protein

View full details