Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Transmembrane protein 47(tmem47)

Recombinant Xenopus laevis Transmembrane protein 47(tmem47)

SKU:CSB-CF023845XBE

Regular price €1.462,95 EUR
Regular price Sale price €1.462,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6IP19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASSASGMEEVRSSVLTPLKLVGLVCIFLALCLDIGAVLSPAWVTADNQYYLSLWESCKK SENRWICDSTLQSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAA VVLQVCGLVLYPIKFIETVTLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY

Protein Names:Recommended name: Transmembrane protein 47 Alternative name(s): Transmembrane 4 superfamily member 10

Gene Names:Name:tmem47 Synonyms:tm4sf10

Expression Region:1-179

Sequence Info:full length protein

View full details