Gene Bio Systems
Recombinant Xenopus laevis TM2 domain-containing protein 2(tm2d2)
Recombinant Xenopus laevis TM2 domain-containing protein 2(tm2d2)
SKU:CSB-CF730366XBE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q5XGR4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QNNTSPVTYPDINVSAAPEPRDPLGPLVLCSYLPEEFVECDDPVDHMGNGTAQQELRYGC KKFGGQAYGDVEHTQVMCRALDGIECDGSRSFLRGNRPCIKYTGHYFITTLLYSFFLGCF GVDRFCLGHTGTAVGKLLTWGGLGIWWFVDLILLITGGLMPSDNSNWCTIY
Protein Names:Recommended name: TM2 domain-containing protein 2
Gene Names:Name:tm2d2
Expression Region:28-198
Sequence Info:full length protein
