Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Serine palmitoyltransferase small subunit A-B(sptssa-b)

Recombinant Xenopus laevis Serine palmitoyltransferase small subunit A-B(sptssa-b)

SKU:CSB-CF753580XBE

Regular price €1.361,95 EUR
Regular price Sale price €1.361,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GPZ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKVSCEDVNGPRSSLGRAWNHVSWLYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYT GYIFMPQHILAILHYFEIVQ

Protein Names:Recommended name: Serine palmitoyltransferase small subunit A-B Alternative name(s): Small subunit of serine palmitoyltransferase A-B Short name= ssSPTa-B

Gene Names:Name:sptssa-b Synonyms:ssspta-b

Expression Region:1-80

Sequence Info:full length protein

View full details