
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q5XGR0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDSSGGAYLNVDAIWSKVGFVRLLQMLFGCTTFSLVLHRAGFSAAYGTFCVFVWAFCFAL TILIVTCELTRLQSCLRSISWGNFTAAYAMLATLMTLTAAVIYPMYFTSLNCSSSDCSTK YFRLAVSVCAALLFVTYAVEVFLTRAKPGQPCSYMATASGLLKVVQAFVACVIFGALASE SQYKKFVATQWCVAVYSFCFGVTMVVVILNITGRALSLCCPFERFVVIYTVLAILMYISA AVIWPVYFFDSKYGSAKRPSRCTWGQCPWDSQLAVTIFTHINLILYIADLIYTQRLRIVA QR
Protein Names:Recommended name: Myeloid-associated differentiation marker-like protein 2
Gene Names:Name:myadml2
Expression Region:1-302
Sequence Info:full length protein
You may also like
-
Recombinant Xenopus laevis Protein YIF1B-B(yif1b-b)
- Regular price
- €1.159,95 EUR
- Sale price
- €1.159,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Xenopus laevis Protein YIF1B-A(yif1b-a)
- Regular price
- €1.159,95 EUR
- Sale price
- €1.159,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Xenopus laevis UPF0458 protein C7orf42 homolog
- Regular price
- €1.170,95 EUR
- Sale price
- €1.170,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Xenopus laevis Myelin proteolipid protein B(plp1-b)
- Regular price
- €1.145,95 EUR
- Sale price
- €1.145,95 EUR
- Regular price
-
- Unit price
- per
Sold out