Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Glutamate receptor, ionotropic kainate 2(grik2)

Recombinant Xenopus laevis Glutamate receptor, ionotropic kainate 2(grik2)

SKU:CSB-CF820942XBE

Regular price €1.570,95 EUR
Regular price Sale price €1.570,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q91755

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYG AVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRALTSDYAFLMESTTIE FVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNG CPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVE ELRMSLKCQRRLKHKPQPPVIVKTEEVINMHTFNDRRLPGKETMA

Protein Names:Recommended name: Glutamate receptor, ionotropic kainate 2 Alternative name(s): Glutamate receptor 6 Short name= GluR-6 Short name= GluR6

Gene Names:Name:grik2 Synonyms:glur6

Expression Region:1-285

Sequence Info:full length protein

View full details