Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis DNA damage-regulated autophagy modulator protein 1(dram1)

Recombinant Xenopus laevis DNA damage-regulated autophagy modulator protein 1(dram1)

SKU:CSB-CF764654XBE

Regular price €1.514,95 EUR
Regular price Sale price €1.514,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6NRS6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHCWCLQGAAFLPSILVIWSSAGFLFSYIISVLIGHVPPFVPYISDTGTSPPESGVFGFM ISVSAMLGAATMYTRYMILERQNLSIDFLPIYFNKISLAIGLFGCIGMGIVATFQEMAVP AVHDAGALITFICGVMYILLQSYISYKSCPTWNTRATCHIRMTVSLIAFIAVVPMSVFSI LSGRKRLDWKPSDEGYPYHLTSAICEWTVAFGFNMYFLTFIRDFQGVSIQISTEIHEDF

Protein Names:Recommended name: DNA damage-regulated autophagy modulator protein 1 Alternative name(s): Damage-regulated autophagy modulator

Gene Names:Name:dram1 Synonyms:dram

Expression Region:1-239

Sequence Info:full length protein

View full details